PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0611s0190.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 609aa    MW: 65913.9 Da    PI: 8.4792
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0611s0190.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.61e-23219263145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRC r+++ ++k+CErH++rgr+rsrk++e 
  SapurV1A.0611s0190.1.p 219 DPEPGRCRRTDGKKWRCARDAVTDQKYCERHMNRGRHRSRKPVEG 263
                             79****************************************985 PP

2QLQ59.69e-21150185237
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                             +FT +Q+++L++Q+l+yKy++an+P+P++L+ +i+k
  SapurV1A.0611s0190.1.p 150 PFTQSQWMELEHQALIYKYISANVPIPSNLIIPIRK 185
                             8*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.1E-11149185IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.005150185IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.7E-16150184IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.688219263IPR014977WRC domain
PfamPF088794.0E-20220262IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MDFGVQVGLD GLVGSDTSNS GFASLASSDP EAKQRLYGSG FFKQERPGNV DGDWRSSKLS  60
KTESMLLEQS NTSFLKSSSN SLFSNGQQQQ QQMLSFSCPK PAPSVERSSQ NATLPYFHLT  120
SSAHNRNTGY SSGIFNAASM HGVLTETRWP FTQSQWMELE HQALIYKYIS ANVPIPSNLI  180
IPIRKALDSS GFPSFSAGFF RPNTLPWGAF HMGFSSNTDP EPGRCRRTDG KKWRCARDAV  240
TDQKYCERHM NRGRHRSRKP VEGQSGHSAA TTTTVKPANG TSSSTSATVV GLRSAVSDSL  300
TIAHNQQQGA SPSNLSASNT LSRMFLAKES GGERTRDASA LSMLQSNIDL KSKETPFFIS  360
KQQDSYGESL RNEFGLVTSD SLLHHSQRSS SLMSCRNFGS SQDLTDQESV SQHSLRQFMD  420
DWPKSQSDRS AVSWPELDQQ SERTQLSISI PMAPADFMSS TSSPNNEKIN LSPLRLSREF  480
DPIQMGLGVG GGGLANEPPN QKQANWIPIS WGTSMGGPLG EVLHSTNNNA AAAECKTTSS  540
LNLMTYRWDN SRIGSSPTGV LQKSAFASLS NSSAGSSPRA ENKTNEGGSL CNDLLGSTIV  600
HSSSLPAM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4733683e-63AM473368.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X262323.6, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010999912.10.0PREDICTED: growth-regulating factor 1-like
TrEMBLB9IBN50.0B9IBN5_POPTR; Uncharacterized protein
STRINGPOPTR_0014s01320.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.16e-83growth-regulating factor 1